PDB entry 3mou

View 3mou on RCSB PDB site
Description: Characterization of the Inhibitor Binding Site of the Dehaloperoxidase-Hemoglobin from Amphitrite ornata using High-Pressure Xenon Derivatization
Class: oxidoreductase
Keywords: globin, peroxidase, OXIDOREDUCTASE
Deposited on 2010-04-23, released 2011-04-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.198
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhp A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3moua_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhp A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3moub_
  • Heterogens: HEM, XE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mouA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mouB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk