PDB entry 3mng

View 3mng on RCSB PDB site
Description: wild type human PrxV with DTT bound as a competitive inhibitor
Class: oxidoreductase
Keywords: peroxiredoxin, peroxidase, PrxV, substrate analog, DTT, OXIDOREDUCTASE
Deposited on 2010-04-21, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.114
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxiredoxin-5, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ACR1, aoeb166, arc1, pmp20, PRDX5, SBBI10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mnga_
  • Heterogens: D1D, BR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mngA (A:)
    mrgshhhhhhgsapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcs
    kthlpgfveqaealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgket
    dlllddslvsifgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mngA (A:)
    apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
    alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
    gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql