PDB entry 3miz

View 3miz on RCSB PDB site
Description: Crystal structure of a putative transcriptional regulator protein, Lacl family from Rhizobium etli
Class: transcription regulator
Keywords: Lacl family, Protein Structure Initiative II (PSI II), NYSGXRC, Structural Genomics, New York SGX Research Center for Structural Genomics, TRANSCRIPTION REGULATOR
Deposited on 2010-04-12, released 2010-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.238
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator protein, LacI family
    Species: Rhizobium etli [TaxId:347834]
    Gene: RHE_PE00360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3miza_
  • Chain 'B':
    Compound: Putative transcriptional regulator protein, LacI family
    Species: Rhizobium etli [TaxId:347834]
    Gene: RHE_PE00360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mizb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mizA (A:)
    mslaarlirssrsntfgiitdyvsttpysvdivrgiqdwanangktiliantggsserev
    eiwkmfqshridgvlyvtmyrrivdpesgdvsiptvmincrpqtrellpsiepddyqgar
    dltryllerghrrigyirlnpillgaelrldafrrttsefgltendlsislgmdgpvgae
    nnyvfaaatemlkqddrptaimsgndemaiqiyiaamalglripqdvsivgfddfrtvtm
    alkpelttaalpyydlgregakwlndliagekiypgsrvvscklverssaafgeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mizA (A:)
    rsntfgiitdyvsttpysvdivrgiqdwanangktiliantggssereveiwkmfqshri
    dgvlyvtmyrrivdpesgdvsiptvmincrpqtrellpsiepddyqgardltryllergh
    rrigyirlnpillgaelrldafrrttsefgltendlsislgmdgpvgaennyvfaaatem
    lkqddrptaimsgndemaiqiyiaamalglripqdvsivgfddfrtvtmalkpelttaal
    pyydlgregakwlndliagekiypgsrvvscklverssaaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mizB (B:)
    mslaarlirssrsntfgiitdyvsttpysvdivrgiqdwanangktiliantggsserev
    eiwkmfqshridgvlyvtmyrrivdpesgdvsiptvmincrpqtrellpsiepddyqgar
    dltryllerghrrigyirlnpillgaelrldafrrttsefgltendlsislgmdgpvgae
    nnyvfaaatemlkqddrptaimsgndemaiqiyiaamalglripqdvsivgfddfrtvtm
    alkpelttaalpyydlgregakwlndliagekiypgsrvvscklverssaafgeghhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mizB (B:)
    sntfgiitdyvsttpysvdivrgiqdwanangktiliantggssereveiwkmfqshrid
    gvlyvtmyrrivdpesgdvsiptvmincrpqtrellpsiepddyqgardltryllerghr
    rigyirlnpillgaelrldafrrttsefgltendlsislgmdgpvgaennyvfaaateml
    kqddrptaimsgndemaiqiyiaamalglripqdvsivgfddfrtvtmalkpelttaalp
    yydlgregakwlndliagekiypgsrvvscklverssaafg