SCOPe 2.07: Domain d3miza_: 3miz A:

Lineage for d3miza_ (3miz A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (71 species)
   not a true protein

7. Species Rhizobium etli [TaxId:347834] [232922] (1 PDB entry)

8. Domain d3miza_: 3miz A: [232924]
   automated match to d3tb6b_

Details for d3miza_

PDB Entry: 3miz, 1.91 Å

PDB Description: Crystal structure of a putative transcriptional regulator protein, Lacl family from Rhizobium etli

PDB Compounds: (A:) Putative transcriptional regulator protein, LacI family

SCOPe Domain Sequences for d3miza_:

Sequence; same for both SEQRES and ATOM records:

>d3miza_ c.93.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]}
rsntfgiitdyvsttpysvdivrgiqdwanangktiliantggssereveiwkmfqshri
dgvlyvtmyrrivdpesgdvsiptvmincrpqtrellpsiepddyqgardltryllergh
rrigyirlnpillgaelrldafrrttsefgltendlsislgmdgpvgaennyvfaaatem
lkqddrptaimsgndemaiqiyiaamalglripqdvsivgfddfrtvtmalkpelttaal
pyydlgregakwlndliagekiypgsrvvscklverssaaf

Timeline for d3miza_:

• d3miza_ first appeared in SCOPe 2.03
  
• d3miza_ appears in SCOPe 2.06