PDB entry 3mhr

View 3mhr on RCSB PDB site
Description: 14-3-3 sigma in complex with YAP pS127-peptide
Class: peptide binding protein
Keywords: 14-3-3, YAP, adapter protein, protein-protein interaction, PEPTIDE BINDING PROTEIN
Deposited on 2010-04-08, released 2010-09-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.128
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: HME1, NM_006142, SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
    Domains in SCOPe 2.02: d3mhra_
  • Chain 'P':
    Compound: YAP phosphopeptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MHR (0-9)
  • Heterogens: MG, CL, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mhrA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.