PDB entry 3m4h

View 3m4h on RCSB PDB site
Description: Human Aldose Reductase mutant T113V complexed with IDD388
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: T113V mutant, oxidoreductase, NADP, Phosphoprotein, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-03-11, released 2010-12-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.103
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-315)
      • see remark 999 (4)
      • engineered mutation (113)
    Domains in SCOPe 2.04: d3m4ha_
  • Heterogens: NAP, 388, CIT, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3m4hA (A:)
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwpvgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
llsctshkdypfheef