PDB entry 3m09

View 3m09 on RCSB PDB site
Description: F98Y TMP-resistant Dihydrofolate Reductase from Staphylococcus aureus with inhibitor RAB1
Class: Oxidoreductase/Oxidoreductase Inhibitor
Keywords: folate, dhfr, antimicrobial, antibiotic resistance, NADP, One-carbon metabolism, Oxidoreductase, Oxidoreductase-Oxidoreductase Inhibitor complex
Deposited on 2010-03-02, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: folA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A017 (0-156)
    • engineered (97)
    • expression tag (157-160)
  Domains in SCOPe 2.07: d3m09a1, d3m09a2
• Heterogens: RAR, NAP, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3m09A (A:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirkavpr