PDB entry 3ly4

View 3ly4 on RCSB PDB site
Description: Crystal Structure of fluorophore-labeled Class A -lactamase PenP-E166Cb in compelx with penicillin G
Class: hydrolase
Keywords: beta-lactamase, fluorophore, biosensor, hydrolase, Antibiotic resistance, Cell membrane, Lipoprotein, Membrane, Palmitate
Deposited on 2010-02-26, released 2011-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase
  Species: Bacillus licheniformis [TaxId:1402]
  Gene: penP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00808 (0-256)
    • engineered mutation (133)
  Domains in SCOPe 2.04: d3ly4a_
• Heterogens: PNM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ly4A (A:)
  kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
  qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
  rkigdevtnperfcpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
  rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
  ddkliaeatkvvmkaln