SCOPe 2.07: Structural Classification of Proteins

PDB entry 3loi

View 3loi on RCSB PDB site
Description: Crystal structures of Cupin superfamily BbDUF985 from Branchiostoma belcheri tsingtauense in the apo and GDP-bound forms
Class: unknown function
Keywords: Beta barrel, UNKNOWN FUNCTION
Deposited on 2010-02-04, released 2010-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative uncharacterized protein
Species: Branchiostoma belcheri tsingtauense [TaxId:155462]
Database cross-references and differences (RAF-indexed):
- Uniprot Q6WRH7
Domains in SCOPe 2.07: d3loia_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3loiA (A:)
maatvdtmseevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylm
qagqpdpfhrvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrv
wfaqevdgyclasvlvapgfdfkdfslgkreelikeypqhrdvimrctssdp

Sequence, based on observed residues (ATOM records): (download)

>3loiA (A:)
eevkrlialyeltphpasggwfretyrsdvqveaegfdgkrsvltmiyylmqagqpdpfh
rvksdetfvhnlggsmkihmihpdgsyscsilgnplehpearhqvvvprrvwfaqevdgy
clasvlvapgfdfkdfslgkreelikeypqhrdvimrctss