PDB entry 3lnq

View 3lnq on RCSB PDB site
Description: Structure of Aristaless homeodomain in complex with DNA
Class: Gene Regulation/DNA
Keywords: HOMEODOMAIN, PROTEIN-DNA COMPLEX, Developmental protein, DNA-binding, Homeobox, Nucleus, Gene Regulation-DNA complex
Deposited on 2010-02-02, released 2010-04-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein aristaless
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: al, CG3935
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3lnqa_
  • Chain 'B':
    Compound: 5'-d(*gp*gp*gp*tp*tp*tp*ap*ap*tp*tp*ap*gp*gp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*cp*cp*tp*ap*ap*tp*tp*ap*ap*ap*cp*cp*c)-3'
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3lnqA (A:)
    ryrttftsfqleelekafsrthypdvftreelamkiglteariqvwfqnrrakwrkqe
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.