PDB entry 3lka

View 3lka on RCSB PDB site
Description: Catalytic domain of human MMP-12 complexed with hydroxamic acid and paramethoxy-sulfonyl amide
Class: hydrolase
Keywords: matrix metalloproteinase, MMP12, elastase, complex (elastase-inhibitor), metallo elastase, extracellular matrix, glycoprotein, hydrolase, metal-binding, metalloprotease
Deposited on 2010-01-27, released 2010-05-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: HME, MMP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered (65)
  Domains in SCOPe 2.04: d3lkaa_
• Heterogens: ZN, CA, HAE, M4S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3lkaA (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg