PDB entry 3lh4

View 3lh4 on RCSB PDB site
Description: Crystal Structure of Sialostatin L2
Class: hydrolase inhibitor
Keywords: beta sheet, cystatin, Protease inhibitor, Thiol protease inhibitor, HYDROLASE INHIBITOR
Deposited on 2010-01-21, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secreted cystatin
    Species: Ixodes scapularis [TaxId:6945]
    Gene: IscW_ISCW018602
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7PKZ1 (1-114)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d3lh4a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lh4A (A:)
melalrggyrersnqddpeylelahyatstwsaqqpgkthfdtvvevlkvetqtvagtny
rltlkvaestceltstynkdtcqananaaqrtcttviyrnlqgeksissfecaaa