PDB entry 3l8q

View 3l8q on RCSB PDB site
Description: Structure analysis of the type II cohesin dyad from the adaptor ScaA scaffoldin of Acetivibrio cellulolyticus
Class: structural protein, protein binding
Keywords: Dockerin-binding module, protein-protein interactions, linker segment, scaffoldin arrangement, beta sandwich, alpha helix, beta flaps, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2010-01-03, released 2010-05-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-02, with a file datestamp of 2010-05-28.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.18
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (1-End)
      • expression tag (0)
      • see remark 999 (169)
    Domains in SCOPe 2.06: d3l8qa1, d3l8qa2, d3l8qa3
  • Chain 'B':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (1-End)
      • expression tag (0)
      • see remark 999 (169)
    Domains in SCOPe 2.06: d3l8qb1, d3l8qb2, d3l8qb3
  • Chain 'C':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3
      • see remark 999 (169)
    Domains in SCOPe 2.06: d3l8qc1, d3l8qc2
  • Chain 'D':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3
      • see remark 999 (169)
    Domains in SCOPe 2.06: d3l8qd1, d3l8qd2
  • Heterogens: EDO, PDO, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l8qA (A:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsapiatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8qA (A:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3l8qB (B:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsapiatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8qB (B:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsapia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3l8qC (C:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsapiatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8qC (C:)
    ptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytkst
    mpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvlk
    eetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgydkn
    aaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellvse
    dygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvfed
    setmpngitgttlfnwygnriqsgyfviqpgeins
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3l8qD (D:)
    maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
    stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
    lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgyd
    knaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellv
    sedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvf
    edsetmpngitgttlfnwygnriqsgyfviqpgeinsapiatlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l8qD (D:)
    tssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytkstm
    pgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvlke
    etssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmtkasyitmgydkna
    aevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnsslptsgellvsed
    ygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlqkkattvvfeds
    etmpngitgttlfnwygnriqsgyfviqpgeinsapi