![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins) Pfam PF00963 |
![]() | Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species) |
![]() | Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries) Uniprot Q7WYN3 29-199 |
![]() | Domain d3l8qd2: 3l8q D:173-340 [247424] Other proteins in same PDB: d3l8qa3, d3l8qb3 automated match to d3f2la_ complexed with edo, hez, pdo |
PDB Entry: 3l8q (more details), 1.57 Å
SCOPe Domain Sequences for d3l8qd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8qd2 b.2.2.2 (D:173-340) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]} syitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnssl ptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlq kkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsapi
Timeline for d3l8qd2: