PDB entry 3l7w

View 3l7w on RCSB PDB site
Description: The Crystal Structure of smu.1704 from Streptococcus mutans UA159
Class: transcription
Keywords: PadR, transcriptional factor, TRANSCRIPTION
Deposited on 2009-12-29, released 2010-12-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein SMU.1704
    Species: Streptococcus mutans [TaxId:210007]
    Gene: SMU.1704
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3l7wa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l7wA (A:)
    myypvsallieylilaivskhdsygydisqtikliasikestlypilkklekagylstyt
    qehqgrrrkyyhltdsgekhlvyltkewsvykmtidgivegrirhdkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l7wA (A:)
    myypvsallieylilaivskhdsygydisqtikliasikestlypilkklekagylstyt
    qehqgrrrkyyhltdsgekhlvyltkewsvykmtidgivegrirhd