PDB entry 3l1z

View 3l1z on RCSB PDB site
Description: Crystal structure of the U-BOX domain of human E4B ubiquitin ligase in complex with UBCH5C E2 ubiquitin conjugating enzyme
Class: ligase
Keywords: e4b, ufd2a, ubch5c, u-box ubiquitin ligase, e2 ubiquitin conjugating enzyme, ubl conjugation pathway, ligase
Deposited on 2009-12-14, released 2010-05-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: 0.236
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 D3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D3, UBCH5C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61077 (10-156)
      • expression tag (5-9)
    Domains in SCOPe 2.04: d3l1za_
  • Chain 'B':
    Compound: Ubiquitin conjugation factor E4 B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE4B, HDNB1, KIAA0684, UFD2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l1zA (A:)
    mhhhhhhmnsmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvf
    fltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsll
    cdpnpddplvpeiariyktdrdkynrisrewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l1zA (A:)
    hhmnsmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
    fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
    ddplvpeiariyktdrdkynrisrewtqkyam
    

  • Chain 'B':
    No sequence available.