PDB entry 3kse

View 3kse on RCSB PDB site
Description: Unreduced cathepsin L in complex with stefin A
Class: Hydrolase/Hydrolase inhibitor
Keywords: cathepsin, protease-inhibitor complex, stefin, cystatin, papain-like, cysteine protease, Hydrolase, Lysosome, Protease, Thiol protease, Zymogen, Thiol protease inhibitor, Hydrolase-Hydrolase inhibitor complex
Deposited on 2009-11-22, released 2010-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.153
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cathepsin L1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-219)
    • engineered mutation (109)
    • engineered mutation (178)
• Chain 'B':
  Compound: Cathepsin L1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-219)
    • engineered mutation (109)
    • engineered mutation (178)
• Chain 'C':
  Compound: Cathepsin L1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07711 (0-219)
    • engineered mutation (109)
    • engineered mutation (178)
• Chain 'D':
  Compound: Cystatin-A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01040 (0-97)
  Domains in SCOPe 2.06: d3ksed_
• Chain 'E':
  Compound: Cystatin-A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01040 (0-97)
  Domains in SCOPe 2.06: d3ksee_
• Chain 'F':
  Compound: Cystatin-A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01040 (0-97)
  Domains in SCOPe 2.06: d3ksef_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kseD (D:)
  mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
  dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kseE (E:)
  mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
  dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3kseF (F:)
  mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
  dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf