PDB entry 3klr

View 3klr on RCSB PDB site
Description: Bovine H-protein at 0.88 angstrom resolution
Class: oxidoreductase
Keywords: antiparallel beta sheet, beta sandwich, OXIDOREDUCTASE
Deposited on 2009-11-09, released 2010-06-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 0.88 Å
R-factor: 0.111
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine cleavage system H protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3klra_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3klrA (A:)
    svrkftekhewvttengvgtvgisnfaqealgdvvycslpevgtklnkqeefgalesvka
    aselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyi
    ksiee