PDB entry 3kcw

View 3kcw on RCSB PDB site
Description: Crystal structure of Ganoderma fungal immunomodulatory protein, GMI
Class: immune system
Keywords: fniii, immune system
Deposited on 2009-10-22, released 2010-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunomodulatory protein
    Species: Ganoderma microsporum [TaxId:34462]
    Database cross-references and differences (RAF-indexed):
    • PDB 3KCW
    Domains in SCOPe 2.05: d3kcwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3kcwA (A:)
msdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlg
vrpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwnyleqklise
edlnsavdhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3kcwA (A:)
sdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlgv
rpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwn