Lineage for d3kcwa_ (3kcw A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771330Superfamily b.1.21: Fungal immunomodulatory protein, FIP [101542] (1 family) (S)
    automatically mapped to Pfam PF09259
  5. 1771331Family b.1.21.1: Fungal immunomodulatory protein, FIP [101543] (2 proteins)
  6. 1771336Protein automated matches [191068] (2 species)
    not a true protein
  7. 1771340Species Ganoderma microsporum [TaxId:34462] [226009] (1 PDB entry)
  8. 1771341Domain d3kcwa_: 3kcw A: [212294]
    automated match to d3f3ha_

Details for d3kcwa_

PDB Entry: 3kcw (more details), 2 Å

PDB Description: crystal structure of ganoderma fungal immunomodulatory protein, gmi
PDB Compounds: (A:) immunomodulatory protein

SCOPe Domain Sequences for d3kcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kcwa_ b.1.21.1 (A:) automated matches {Ganoderma microsporum [TaxId: 34462]}
sdtaliftlawnvkqlafdytpnwgrgrpssfidtvtfptvltdkaytyrvvvsgkdlgv
rpsyavesdgsqkinfleynsgygiadtntiqvyvidpdtgnnfivaqwn

SCOPe Domain Coordinates for d3kcwa_:

Click to download the PDB-style file with coordinates for d3kcwa_.
(The format of our PDB-style files is described here.)

Timeline for d3kcwa_: