PDB entry 3jwq

View 3jwq on RCSB PDB site
Description: Crystal structure of chimeric PDE5/PDE6 catalytic domain complexed with sildenafil
Class: hydrolase
Keywords: mostly alpha, Allosteric enzyme, cGMP, cGMP-binding, Hydrolase, Magnesium, Metal-binding, Nucleotide-binding, Phosphoprotein, Cell membrane, Lipoprotein, Membrane, Methylation, Prenylation, Sensory transduction, Vision
Deposited on 2009-09-18, released 2009-10-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
  Species: Homo sapiens [TaxId:9606]
  Gene: PDE5A, PDE5, PDE6C, PDEA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76074 (Start-255)
  • Uniprot P51160 (256-295)
  • Uniprot O76074 (296-End)
• Chain 'B':
  Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
  Species: Homo sapiens [TaxId:9606]
  Gene: PDE5A, PDE5, PDE6C, PDEA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76074 (Start-255)
  • Uniprot P51160 (256-295)
  • Uniprot O76074 (296-End)
• Chain 'C':
  Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
  Species: Homo sapiens [TaxId:9606]
  Gene: PDE5A, PDE5, PDE6C, PDEA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76074 (4-255)
    • expression tag (2-3)
  • Uniprot P51160 (256-295)
  • Uniprot O76074 (296-End)
• Chain 'D':
  Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
  Species: Homo sapiens [TaxId:9606]
  Gene: PDE5A, PDE5, PDE6C, PDEA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76074 (Start-255)
  • Uniprot P51160 (256-295)
  • Uniprot O76074 (296-End)
  Domains in SCOPe 2.02: d3jwqd_
• Heterogens: ZN, MG, VIA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3jwqD (D:)
  gshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqm
  khevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaa
  lshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeyk
  ttlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitk
  pwpiqqriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlye
  althvsedcfplldgcrknrqkwqalaeqq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3jwqD (D:)
  trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
  rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
  hrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkii
  kqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqq
  riaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyealthvs
  edcfplldgcrknrqkwqalaeq