PDB entry 3jwq

View 3jwq on RCSB PDB site
Description: Crystal structure of chimeric PDE5/PDE6 catalytic domain complexed with sildenafil
Class: hydrolase
Keywords: mostly alpha, Allosteric enzyme, cGMP, cGMP-binding, Hydrolase, Magnesium, Metal-binding, Nucleotide-binding, Phosphoprotein, Cell membrane, Lipoprotein, Membrane, Methylation, Prenylation, Sensory transduction, Vision
Deposited on 2009-09-18, released 2009-10-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.226
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5, PDE6C, PDEA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5, PDE6C, PDEA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5, PDE6C, PDEA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76074 (4-255)
      • expression tag (2-3)
    • Uniprot P51160 (256-295)
    • Uniprot O76074 (296-End)
  • Chain 'D':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase catalytic domain, Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5, PDE6C, PDEA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jwqd_
  • Heterogens: ZN, MG, VIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3jwqD (D:)
    gshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqm
    khevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaa
    lshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeyk
    ttlkiikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitk
    pwpiqqriaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlye
    althvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jwqD (D:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkii
    kqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqq
    riaelvatefweqgdlertvlqqqpipmmdrnkrdelpklqvgfidfvctqlyealthvs
    edcfplldgcrknrqkwqalaeq