PDB entry 3jvl

View 3jvl on RCSB PDB site
Description: Crystal structure of bromodomain 2 of mouse Brd4
Class: signaling protein
Keywords: bromodomain, alpha helical, N-acetyl lysine binding domain, SIGNALING PROTEIN
Deposited on 2009-09-17, released 2009-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-01-05, with a file datestamp of 2009-12-31.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.117
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: BRD4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESU6 (4-End)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d3jvla1, d3jvla2
  • Heterogens: EDO, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3jvlA (A:)
gamgskiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmsti
ksklesreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpdepee

    Sequence, based on observed residues (ATOM records): (download) 
    >3jvlA (A:)
gamgskiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmsti
ksklesreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd