| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [196526] (5 PDB entries) |
| Domain d3jvla1: 3jvl A:349-460 [212122] Other proteins in same PDB: d3jvla2 automated match to d3jvma_ complexed with bme, edo |
PDB Entry: 3jvl (more details), 1.2 Å
SCOPe Domain Sequences for d3jvla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jvla1 a.29.2.0 (A:349-460) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
skiseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskl
esreyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd
Timeline for d3jvla1: