PDB entry 3jtg
View 3jtg on RCSB PDB site
Description: Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA
Class: transcription
Keywords: Elf3, protein-dna complex, type II TGF-beta receptor, Activator, Alternative splicing, Cytoplasm, Developmental protein, Differentiation, DNA-binding, Inflammatory response, Nucleus, Repressor, Transcription, Transcription regulation
Deposited on
2009-09-11, released
2010-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated
2010-04-28, with a file datestamp of
2010-04-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ETS-related transcription factor Elf-3
Species: Mus musculus [TaxId:10090]
Gene: Elf3, Ert, Esx, Jen
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3jtga_ - Chain 'B':
Compound: DNA (5'-d(*gp*ap*gp*gp*ap*gp*tp*tp*tp*cp*cp*tp*gp*tp*tp*t)-3')
Species: synthetic, synthetic
- Chain 'C':
Compound: DNA (5'-d(*cp*ap*ap*ap*cp*ap*gp*gp*ap*ap*ap*cp*tp*cp*cp*t)-3')
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3jtgA (A:)
aprgthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyek
lsramryyykreilervdgrrlvykfgknssgwkeeevgesrn
Sequence, based on observed residues (ATOM records): (download)
>3jtgA (A:)
gthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyeklsr
amryyykreilervdgrrlvykfgknssgwkeeev
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.