PDB entry 3jtg

View 3jtg on RCSB PDB site
Description: Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA
Class: transcription
Keywords: Elf3, protein-dna complex, type II TGF-beta receptor, Activator, Alternative splicing, Cytoplasm, Developmental protein, Differentiation, DNA-binding, Inflammatory response, Nucleus, Repressor, Transcription, Transcription regulation
Deposited on 2009-09-11, released 2010-01-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.234
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ETS-related transcription factor Elf-3
    Species: Mus musculus [TaxId:10090]
    Gene: Elf3, Ert, Esx, Jen
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3jtga_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*ap*gp*gp*ap*gp*tp*tp*tp*cp*cp*tp*gp*tp*tp*t)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*ap*ap*cp*ap*gp*gp*ap*ap*ap*cp*tp*cp*cp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3jtgA (A:)
    aprgthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyek
    lsramryyykreilervdgrrlvykfgknssgwkeeevgesrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3jtgA (A:)
    gthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyeklsr
    amryyykreilervdgrrlvykfgknssgwkeeev
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.