PDB entry 3irw

View 3irw on RCSB PDB site
Description: Structure of a c-di-GMP riboswitch from V. cholerae
Class: RNA binding protein/RNA
Keywords: riboswitch, c-di-GMP, RNA, RNA binding protein-RNA complex
Deposited on 2009-08-24, released 2009-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.199
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (30)
      • engineered (35)
    Domains in SCOPe 2.04: d3irwp_
  • Chain 'R':
    Compound: c-di-GMP Riboswitch
    Species: Vibrio cholerae, synthetic [TaxId:666]
  • Heterogens: C2E, IRI, MG, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >3irwP (P:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >3irwP (P:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

  • Chain 'R':
    No sequence available.