PDB entry 3ir4

View 3ir4 on RCSB PDB site
Description: 1.2 Angstrom Crystal Structure of the Glutaredoxin 2 (grxB) from Salmonella typhimurium in complex with Glutathione
Class: oxidoreductase
Keywords: Glutaredoxin 2, Glutathione, idp00895, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2009-08-21, released 2009-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutaredoxin 2
  Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
  Gene: grxB, STM1165
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7CQR3 (3-217)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d3ir4a1, d3ir4a2, d3ir4a3
• Heterogens: GSH, CL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ir4A (A:)
  snamklyiydhcpfcvkarmifglknipvelnvlqnddeatptrmigqkmvpilqkddsr
  ylpesmdivhyvdnldgkplltgkrnpaieewlrkvngyvnqlllprfaksafdefstpa
  arqyfirkkeassgsfdnhlahsaglikkigddlrlldklivqpnavngelseddihlfp
  llrnltlvagihwptkvadyrdnmakqtqinllssmai