| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [225742] (1 PDB entry) |
| Domain d3ir4a1: 3ir4 A:1-75 [211845] Other proteins in same PDB: d3ir4a2, d3ir4a3 automated match to d1g7oa2 complexed with cl, gsh, so4 |
PDB Entry: 3ir4 (more details), 1.2 Å
SCOPe Domain Sequences for d3ir4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir4a1 c.47.1.0 (A:1-75) automated matches {Salmonella enterica [TaxId: 99287]}
mklyiydhcpfcvkarmifglknipvelnvlqnddeatptrmigqkmvpilqkddsrylp
esmdivhyvdnldgk
Timeline for d3ir4a1: