PDB entry 3iqj

View 3iqj on RCSB PDB site
Description: Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (10mer)
Class: protein binding, signaling protein
Keywords: SIGNAL TRANSDUCTION, Nucleus, Phosphoprotein, Secreted, ATP-binding, Disease mutation, Kinase, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Zinc-finger, PROTEIN BINDING, SIGNALING PROTEIN
Deposited on 2009-08-20, released 2010-09-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.129
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
    Domains in SCOPe 2.02: d3iqja_
  • Chain 'P':
    Compound: 10-mer peptide from RAF proto-oncogene serine/threonine-protein kinase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3iqjA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.