PDB entry 3in8

View 3in8 on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2 Tripeptide Mimic
Class: signaling protein/peptide
Keywords: ligand preorganization, Golgi apparatus, PEPTIDE MIMICS, Host-virus interaction, Phosphoprotein, SH2 domain, SH3, SIGNALING PROTEIN, SIGNALING PROTEIN-pseudopeptide ligand complex, SIGNALING PROTEIN-PEPTIDE COMPLEX
Deposited on 2009-08-11, released 2009-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth factor receptor-bound protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB2, ASH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62993
  Domains in SCOPe 2.07: d3in8a_
• Heterogens: FYI, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3in8A (A:)
  iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
  dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3in8A (A:)
  mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
  agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp