PDB entry 3iik

View 3iik on RCSB PDB site
Description: The structure of hCINAP-SO4 complex at 1.95 angstroms resolution
Class: protein binding, transferase
Keywords: Alpha and beta proteins (a/b), PROTEIN BINDING, TRANSFERASE, phosphotransferase
Deposited on 2009-08-02, released 2010-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-01-18, with a file datestamp of 2012-01-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.181
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coilin-interacting nuclear ATPase protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CINAP, TAF9, hCG_37060
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5F2S9 (8-179)
      • expression tag (5-7)
    Domains in SCOPe 2.08: d3iika1, d3iika2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3iikA (A:)
    gplgspefmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeyd
    cpildedrvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgyn
    ekkltdniqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3iikA (A:)
    pefmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpild
    edrvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekklt
    dniqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns