Lineage for d3iika1 (3iik A:1-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866286Species Human (Homo sapiens) [TaxId:9606] [187523] (8 PDB entries)
  8. 2866288Domain d3iika1: 3iik A:1-172 [178332]
    Other proteins in same PDB: d3iika2
    automated match to d1rkba_
    complexed with so4

Details for d3iika1

PDB Entry: 3iik (more details), 1.95 Å

PDB Description: The structure of hCINAP-SO4 complex at 1.95 angstroms resolution
PDB Compounds: (A:) Coilin-interacting nuclear ATPase protein

SCOPe Domain Sequences for d3iika1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iika1 c.37.1.1 (A:1-172) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpildedr
vvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdni
qceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns

SCOPe Domain Coordinates for d3iika1:

Click to download the PDB-style file with coordinates for d3iika1.
(The format of our PDB-style files is described here.)

Timeline for d3iika1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iika2