PDB entry 3i9s

View 3i9s on RCSB PDB site
Description: Structure from the mobile metagenome of V.cholerae. Integron cassette protein VCH_CASS6
Class: transferase
Keywords: Integron cassette protein, Vibrio cholerae, Oyster pond, Woods hole, Acetyltransferase, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Transferase
Deposited on 2009-07-13, released 2009-08-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integron cassette protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: A59_A0465
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9S (Start-182)
  • Chain 'B':
    Compound: Integron cassette protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: A59_A0465
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9S
  • Chain 'C':
    Compound: Integron cassette protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: A59_A0465
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9S
  • Chain 'D':
    Compound: Integron cassette protein
    Species: Vibrio cholerae [TaxId:666]
    Gene: A59_A0465
    Database cross-references and differences (RAF-indexed):
    • PDB 3I9S (Start-182)
    Domains in SCOPe 2.02: d3i9sd_
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i9sD (D:)
    mgsshhhhhhssgrenlyfqgmsveikrvdkhhcldlvgifieleryyfgdkaaseqdla
    nylshqvfsehsgvkviaavehdkvlgfatytimfpapklsgqmymkdlfvsssargkgi
    glqlmkhlatiaithncqrldwtaestnptagkfyksigaslirekeyyrfegnglnkla
    ksl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i9sD (D:)
    veikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaavehd
    kvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrldwt
    aestnptagkfyksigaslirekeyyrfegnglnklaksl