PDB entry 3i9s
View 3i9s on RCSB PDB site
Description: Structure from the mobile metagenome of V.cholerae. Integron cassette protein VCH_CASS6
Class: transferase
Keywords: Integron cassette protein, Vibrio cholerae, Oyster pond, Woods hole, Acetyltransferase, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Transferase
Deposited on
2009-07-13, released
2009-08-11
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-08-11, with a file datestamp of
2009-08-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Integron cassette protein
Species: Vibrio cholerae [TaxId:666]
Gene: A59_A0465
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Integron cassette protein
Species: Vibrio cholerae [TaxId:666]
Gene: A59_A0465
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Integron cassette protein
Species: Vibrio cholerae [TaxId:666]
Gene: A59_A0465
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Integron cassette protein
Species: Vibrio cholerae [TaxId:666]
Gene: A59_A0465
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d3i9sd_ - Heterogens: SO4, CL, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3i9sD (D:)
mgsshhhhhhssgrenlyfqgmsveikrvdkhhcldlvgifieleryyfgdkaaseqdla
nylshqvfsehsgvkviaavehdkvlgfatytimfpapklsgqmymkdlfvsssargkgi
glqlmkhlatiaithncqrldwtaestnptagkfyksigaslirekeyyrfegnglnkla
ksl
Sequence, based on observed residues (ATOM records): (download)
>3i9sD (D:)
veikrvdkhhcldlvgifieleryyfgdkaaseqdlanylshqvfsehsgvkviaavehd
kvlgfatytimfpapklsgqmymkdlfvsssargkgiglqlmkhlatiaithncqrldwt
aestnptagkfyksigaslirekeyyrfegnglnklaksl