PDB entry 3hqh

View 3hqh on RCSB PDB site
Description: Structures of SPOP-Substrate Complexes: Insights into Molecular Architectures of BTB-Cul3 Ubiquitin Ligases: SPOPMATHx-MacroH2ASBCpep1
Class: ligase
Keywords: ubiquitin, SPOP, BTB, E3, Nucleus, Ubl conjugation pathway, LIGASE
Deposited on 2009-06-06, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Speckle-type POZ protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SPOP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43791 (6-End)
      • engineered (118)
    Domains in SCOPe 2.07: d3hqha_
  • Chain 'M':
    Compound: MacroH2A
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3HQH
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3hqhA (A:)
gsggsgkvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeesk
dylslylllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgf
lldeangllpddkltlfcevsvvqd

    Sequence, based on observed residues (ATOM records): (download) 
    >3hqhA (A:)
kvvkfsymwtinnfsfcreemgeviksstfssgdklkwclrvnpkgldeeskdylslyll
lvscpevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrgflldeangllp
ddkltlfcevsvvq

  • Chain 'M':
    No sequence available.