PDB entry 3hpw

View 3hpw on RCSB PDB site
Description: CcdB dimer in complex with one C-terminal CcdA domain
Class: toxin/toxin repressor
Keywords: ALPHA+BETA, SH3 domain, intrinsically disordered, TOXIN/TOXIN REPRESSOR COMPLEX
Deposited on 2009-06-05, released 2009-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.167
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxic protein ccdB
    Species: Escherichia coli [TaxId:562]
    Gene: ccdB, ECOK12F043, G, letB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3hpwa_
  • Chain 'B':
    Compound: Cytotoxic protein ccdB
    Species: Escherichia coli [TaxId:562]
    Gene: ccdB, ECOK12F043, G, letB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3hpwb_
  • Chain 'C':
    Compound: Protein ccdA
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hpwA (A:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3hpwB (B:)
    mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
    wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
    

  • Chain 'C':
    No sequence available.