PDB entry 3ho5
View 3ho5 on RCSB PDB site
Description: Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex
Class: signaling protein
Keywords: receptor ectodomain, six-bladed-propeller domain, EGF domain, disulfide bond, calcium cation, zinc cation, Cell membrane, EGF-like domain, Glycoprotein, Membrane, Secreted, Autocatalytic cleavage, Developmental protein, Disease mutation, Holoprosencephaly, Hydrolase, Lipoprotein, Microphthalmia, Palmitate, Protease, SIGNALING PROTEIN
Deposited on
2009-06-01, released
2009-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.234
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hedgehog-interacting protein
Species: Homo sapiens [TaxId:9606]
Gene: HHIP, HIP, UNQ5825/PRO19644
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: hedgehog-interacting protein
Species: Homo sapiens [TaxId:9606]
Gene: HHIP, HIP, UNQ5825/PRO19644
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: Sonic hedgehog protein
Species: Homo sapiens [TaxId:9606]
Gene: SHH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3ho5h_ - Heterogens: ZN, CA
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'H':
Sequence, based on SEQRES records: (download)
>3ho5H (H:)
gfgkrrhpkkltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkd
eentgadrlmtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdi
ttsdrdrskygmlarlaveagfdwvyyeskahihcsvkaensvaaksgg
Sequence, based on observed residues (ATOM records): (download)
>3ho5H (H:)
kltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkdeentgadrl
mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk
ygmlarlaveagfdwvyyeskahihcsvkaensv