Lineage for d3ho5h_ (3ho5 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956780Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956781Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) (S)
    zinc-binding motif
  5. 2956786Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
    automatically mapped to Pfam PF01085
  6. 2956800Protein automated matches [190324] (2 species)
    not a true protein
  7. 2956801Species Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries)
  8. 2956826Domain d3ho5h_: 3ho5 H: [246522]
    automated match to d3m1nb_
    complexed with ca, zn

Details for d3ho5h_

PDB Entry: 3ho5 (more details), 3.01 Å

PDB Description: Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex
PDB Compounds: (H:) Sonic hedgehog protein

SCOPe Domain Sequences for d3ho5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ho5h_ d.65.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kltplaykqfipnvaektlgasgryegkisrnserfkeltpnynpdiifkdeentgadrl
mtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsk
ygmlarlaveagfdwvyyeskahihcsvkaensv

SCOPe Domain Coordinates for d3ho5h_:

Click to download the PDB-style file with coordinates for d3ho5h_.
(The format of our PDB-style files is described here.)

Timeline for d3ho5h_: