PDB entry 3h91

View 3h91 on RCSB PDB site
Description: Crystal structure of the complex of human chromobox homolog 2 (CBX2) and H3K27 peptide
Class: transcription
Keywords: human chromobox homolog 2, CBX2, H3K27, Structural Genomics, Structural Genomics Consortium, SGC, Chromatin regulator, DNA-binding, Nucleus, Repressor, Transcription, Transcription regulation
Deposited on 2009-04-29, released 2009-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h91a_
  • Chain 'B':
    Compound: Chromobox protein homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3h91b_
  • Chain 'C':
    Compound: H3K27 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3H91
  • Chain 'D':
    Compound: H3K27 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 3H91
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3h91A (A:)
eqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqkke

    Sequence, based on observed residues (ATOM records): (download) 
    >3h91A (A:)
eqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3h91B (B:)
eqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqkke

    Sequence, based on observed residues (ATOM records): (download) 
    >3h91B (B:)
eqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqk

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.