PDB entry 3gwx

View 3gwx on RCSB PDB site
Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
Class: transcription regulation
Keywords: ppar, fatty acids, transcription, nuclear receptor fold, transcription regulation
Deposited on 1999-04-26, released 2000-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (peroxisome proliferator activated receptor (ppar-delta))
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gwxa_
  • Chain 'B':
    Compound: protein (peroxisome proliferator activated receptor (ppar-delta))
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gwxb_
  • Heterogens: EPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gwxA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gwxB (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy