Lineage for d3gwxa_ (3gwx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009141Protein Peroxisome proliferator-activated receptor delta, PPAR-DELTA [48526] (1 species)
  7. 2009142Species Human (Homo sapiens) [TaxId:9606] [48527] (16 PDB entries)
  8. 2009161Domain d3gwxa_: 3gwx A: [19325]
    complexed with epa

Details for d3gwxa_

PDB Entry: 3gwx (more details), 2.4 Å

PDB Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
PDB Compounds: (A:) protein (peroxisome proliferator activated receptor (ppar-delta))

SCOPe Domain Sequences for d3gwxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwxa_ a.123.1.1 (A:) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]}
qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
tehaqmmqrikktetetslhpllqeiykdmy

SCOPe Domain Coordinates for d3gwxa_:

Click to download the PDB-style file with coordinates for d3gwxa_.
(The format of our PDB-style files is described here.)

Timeline for d3gwxa_: