PDB entry 3gvi

View 3gvi on RCSB PDB site
Description: Crystal structure of Lactate/malate dehydrogenase from Brucella melitensis in complex with ADP
Class: oxidoreductase
Keywords: LACTATE/MALATE DEHYDROGENASE, BRUCELLA MELITENSIS, NAD, Oxidoreductase, Tricarboxylic acid cycle, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2009-03-31, released 2009-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvia1, d3gvia2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvib1, d3gvib2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvic1, d3gvic2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvid1, d3gvid2
  • Chain 'E':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvie1, d3gvie2
  • Chain 'F':
    Compound: malate dehydrogenase
    Species: Brucella melitensis biovar Abortus 2308 [TaxId:359391]
    Gene: mdh, BAB1_1927
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gvif1, d3gvif2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gviA (A:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviA (A:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapslk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gviB (B:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviB (B:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapslk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3gviC (C:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviC (C:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapslk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3gviD (D:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviD (D:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gviE (E:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviE (E:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapslk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3gviF (F:)
    gpgsmarnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgf
    dakftgandyaaiegadvvivtagvprkpgmsrddllginlkvmeqvgagikkyapeafv
    icitnpldamvwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlggh
    gdsmvplarystvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapa
    asaiqmaesylkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdeka
    qfdksvasvaglceacigiapslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gviF (F:)
    arnkialigsgmiggtlahlaglkelgdvvlfdiaegtpqgkgldiaesspvdgfdakft
    gandyaaiegadvvivtagvprkddllginlkvmeqvgagikkyapeafvicitnpldam
    vwalqkfsglpahkvvgmagvldsarfryflseefnvsvedvtvfvlgghgdsmvplary
    stvagiplpdlvkmgwtsqdkldkiiqrtrdggaeivgllktgsafyapaasaiqmaesy
    lkdkkrvlpvaaqlsgqygvkdmyvgvptvigangveriieidldkdekaqfdksvasva
    glceacigiapslk