PDB entry 3gtu

View 3gtu on RCSB PDB site
Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, heterodimer
Deposited on 1998-07-29, released 1999-07-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.225
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM2, GSTM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gtua1, d3gtua2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM2, GSTM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21266 (0-223)
      • sequencing error (145)
    Domains in SCOPe 2.04: d3gtub1, d3gtub2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM2, GSTM3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gtuc1, d3gtuc2
  • Chain 'D':
    Compound: glutathione s-transferase
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene: GSTM2, GSTM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21266 (0-223)
      • sequencing error (145)
    Domains in SCOPe 2.04: d3gtud1, d3gtud2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuA (A:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuB (B:)
    scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
    pnlpylldgknkitqsnailryiarkhnmcgeteeekirvdiienqvmdfrtqlirlcys
    sdheklkpqyleelpgqlkqfsmflgkfswfagekltfvdfltydildqnrifdpkclde
    fpnlkafmcrfealekiaaylqsdqfckmpinnkmaqwgnkpvc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuC (C:)
    pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgthkitqsnailryiarkhnlcgesekeqiredilenqfmdsrmqlaklcydpdfe
    klkpeylqalpemlklysqflgkqpwflgdkitfvdfiaydvlernqvfepscldafpnl
    kdfisrfeglekisaymkssrflprpvftkmavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gtuD (D:)
    scessmvlgywdirglahairllleftdtsyeekrytcgeapdydrsqwldvkfkldldf
    pnlpylldgknkitqsnailryiarkhnmcgeteeekirvdiienqvmdfrtqlirlcys
    sdheklkpqyleelpgqlkqfsmflgkfswfagekltfvdfltydildqnrifdpkclde
    fpnlkafmcrfealekiaaylqsdqfckmpinnkmaqwgnkpvc