PDB entry 3gr6

View 3gr6 on RCSB PDB site
Description: Crystal structure of the staphylococcus aureus enoyl-acyl carrier protein reductase (fabI) in complex with NADP and triclosan
Class: oxidoreductase
Keywords: Enoyl reductase, NADP, Triclosan, OXIDOREDUCTASE
Deposited on 2009-03-25, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gr6a_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: FabI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GI75 (4-259)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3gr6d1, d3gr6d2
  • Chain 'G':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: FabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3gr6g_
  • Chain 'J':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: STAPHYLOCOCCUS AUREUS [TaxId:1280]
    Gene: FabI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GI75 (4-259)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d3gr6j1, d3gr6j2
  • Heterogens: NAP, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gr6A (A:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfll
    aqdissysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylal
    dlgpdnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsd
    lssgvtgenihvdsgfhaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gr6A (A:)
    lnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpeah
    lyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdis
    sysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgpd
    nirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsdlssgv
    tgenihvdsgfhaik
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gr6D (D:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfll
    aqdissysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylal
    dlgpdnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsd
    lssgvtgenihvdsgfhaik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3gr6G (G:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfll
    aqdissysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylal
    dlgpdnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsd
    lssgvtgenihvdsgfhaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gr6G (G:)
    nlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqlnqpeahl
    yqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfllaqdiss
    ysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylaldlgpdn
    irvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsdlssgvt
    genihvdsgfhaik
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gr6J (J:)
    laaamlnlenktyvimgiankrsiafgvakvldqlgaklvftyrkersrkeleklleqln
    qpeahlyqidvqsdeevingfeqigkdvgnidgvyhsiafanmedlrgrfsetsregfll
    aqdissysltivaheakklmpeggsivattylggefavqnynvmgvakasleanvkylal
    dlgpdnirvnaisagpirtlsakgvggfntilkeieeraplkrnvdqvevgktaayllsd
    lssgvtgenihvdsgfhaik