PDB entry 3gmx

View 3gmx on RCSB PDB site
Description: Crystal Structure of Beta-Lactamse Inhibitory Protein-Like Protein (BLP) at 1.05 Angstrom Resolution
Class: protein binding
Keywords: 2-layer alpha/beta sandwich, PROTEIN BINDING
Deposited on 2009-03-15, released 2009-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: blp
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: blp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gmxa_
  • Chain 'B':
    Compound: blp
    Species: Streptomyces clavuligerus [TaxId:1901]
    Gene: blp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gmxb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmxA (A:)
    ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
    lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
    reyvcpskaerfapsayftftdgkltsrsqsqlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gmxB (B:)
    ytgftperynkiqfgmdrtlvwqlagadqscsdqveriicynnpdhygpqghfffnaadk
    lihkrqmelfpapkptmrlatynktqtgmteaqfwaavpsdtcsalaeqypnwpatngnl
    reyvcpskaerfapsayftftdgkltsrsqsqlp