PDB entry 3gcx

View 3gcx on RCSB PDB site
Description: PCSK9:EGFA (pH 7.4)
Class: protein binding
Keywords: PCSK9, LDL receptor, Autocatalytic cleavage, Cholesterol metabolism, Disease mutation, Glycoprotein, Hydrolase, Lipid metabolism, Phosphoprotein, Protease, Secreted, Serine protease, Steroid metabolism, Zymogen, Coated pit, EGF-like domain, Endocytosis, Host-virus interaction, LDL, Lipid transport, Membrane, Receptor, Transmembrane, Transport, PROTEIN BINDING
Deposited on 2009-02-22, released 2009-03-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.228
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01130 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d3gcxe1, d3gcxe2
  • Chain 'P':
    Compound: Proprotein convertase subtilisin/kexin type 9
    Species: Homo sapiens [TaxId:9606]
    Gene: PCSK9, NARC1, PSEC0052
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3gcxE (E:)
    gamgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvn
    leggykcqceegfqldphtkack
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcxE (E:)
    mgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce
    

  • Chain 'P':
    No sequence available.