PDB entry 3gbo

View 3gbo on RCSB PDB site
Description: Crystal structure of BmooMPalpha-I, a non-hemorrhagic metalloproteinase isolated from Bothrops moojeni snake venom
Class: hydrolase
Keywords: snake venom metalloproteinase, Hydrolase, Metal-binding, Metalloprotease, Protease, Secreted, Toxin, Zinc
Deposited on 2009-02-20, released 2009-09-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-02-16, with a file datestamp of 2010-02-12.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc metalloproteinase BmooMPalfa-I
  Species: Bothrops moojeni [TaxId:98334]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P85314 (0-199)
    • conflict (97)
    • conflict (169)
  Domains in SCOPe 2.04: d3gboa_
• Heterogens: CA, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3gboA (A:)
  fsprhielvvvadhgmfkkynsnlntirkwvhemvnsmngfyrsvdvtaslanlevwskk
  dlinvqkdsretlksfgewrerdllprishdnaqllttivfdghvigraftggmcdprhs
  vgvvmdhspknlqvavtmahelghnlgmhhdgnqchcdaascimadslsqvlsyefsdcs
  qnqyqtyltkhnpqcilnep