PDB entry 3ga3

View 3ga3 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of human MDA5
Class: hydrolase
Keywords: Innate immune receptor, RNA biniding, helicase, RLR, Alternative splicing, Antiviral defense, ATP-binding, Cytoplasm, Diabetes mellitus, Host-virus interaction, Hydrolase, Immune response, Innate immunity, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, RNA-binding
Deposited on 2009-02-16, released 2009-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-20.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.18
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-induced helicase C domain-containing protein 1, MDA5
    Species: Homo sapiens [TaxId:9606]
    Gene: IFIH1, IFIH1 or MDA5, MDA5, RH116
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BYX4 (0-124)
      • expression tag (125-132)
    Domains in SCOPe 2.07: d3ga3a1, d3ga3a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ga3A (A:)
    akhyknnpslitflckncsvlacsgedihviekmhhvnmtpefkelyivrenkalqkkca
    dyqingeiickcgqawgtmmvhkgldlpclkirnfvvvfknnstkkqykkwvelpitfpn
    ldyselehhhhhh