PDB entry 3fqo

View 3fqo on RCSB PDB site
Description: Staphylococcus aureus F98Y mutant dihydrofolate reductase complexed with NADPH and 2,4-diamino-5-[3-(2,5-dimethoxyphenyl)prop-1-ynyl]-6-ethylpyrimidine (UCP120B)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-01-07, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trimethoprim-sensitive dihydrofolate reductase
  Species: Staphylococcus aureus RF122 [TaxId:273036]
  Gene: dfrB, SAB1281c
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2YY41 (0-156)
    • engineered (97)
  Domains in SCOPe 2.07: d3fqoa_
• Heterogens: NDP, N22, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3fqoA (A:)
  tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
  vltsdtsfnvegvdvihsiediyqlpghvfifggqtlyeemidkvddmyitviegkfrgd
  tffppytfedwevassvegkldekntiphtflhlirk