PDB entry 3fou

View 3fou on RCSB PDB site
Description: Low pH structure of the Rieske protein from Thermus thermophilus at 2.1 A
Class: electron transport
Keywords: Rieske protein, Pr, [2Fe-2S], ELECTRON TRANSPORT
Deposited on 2009-01-02, released 2009-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3foua_
  • Chain 'B':
    Compound: Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA1931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3foub_
  • Heterogens: FES, PR, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fouA (A:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fouB (B:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqa