![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [189085] (1 PDB entry) |
![]() | Domain d3foua_: 3fou A: [175947] automated match to d1nyka_ complexed with act, ca, fes, pr |
PDB Entry: 3fou (more details), 2.1 Å
SCOPe Domain Sequences for d3foua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3foua_ b.33.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq viagppprpvpqlpvrvedgvlvaageflgpvgvqa
Timeline for d3foua_: