PDB entry 3foo

View 3foo on RCSB PDB site
Description: A Triangular Cytochrome b562 Superstructure Mediated by Ni Coordination - Monoclinic Form
Class: electron transport
Keywords: Four Helix Bundle, Electron transport, Heme, Iron, Metal-binding, Transport
Deposited on 2008-12-30, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooa_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3foob_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3food_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooe_
  • Chain 'F':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3foof_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3foog_
  • Chain 'H':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooh_
  • Chain 'I':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooi_
  • Chain 'J':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fooj_
  • Chain 'K':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fook_
  • Chain 'L':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered (58)
      • engineered (61-62)
      • engineered (65)
      • engineered (76)
      • engineered (97)
      • engineered (100)
    Domains in SCOPe 2.07: d3fool_
  • Heterogens: HEM, PXX, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooE (E:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooF (F:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooG (G:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooH (H:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooI (I:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooJ (J:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooK (K:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fooL (L:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfhilvgqiddalhlanegkvkeaqaaaeqlkttcnachqkyr